CHCHD2 Recombinant monoclonal antibody

• 

  WB analysis using 82702-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 82702-1-RR (CHCHD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 82702-1-RR

  WB result of CHCHD2 antibody (82702-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CHCHD2 transfected HEK-293 cells.

• 

  IF Staining of HepG2 using 82702-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CHCHD2 antibody (82702-1-RR, Clone: 4A12 ) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 82702-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82702-1-RR against Human CHCHD2 were performed. The affinity constant is 2.12 nM.

• Featured Product
• KD/KO Validated

CHCHD2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 82702-1-RR

Clone No.4A12

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

Synonyms

HCV NS2 trans-regulated protein, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, C7orf17, Aging-associated gene 10 protein, AAG10

---

Tested Applications

• Positive WB detected in: HEK-293 cells, LNCaP cells, Jurkat cells, K-562 cells, HSC-T6 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82702-1-RR targets CHCHD2 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13752

  Product name: Recombinant human CHCHD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC003079

  Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 2
• Calculated Molecular Weight: 151 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC003079
• Gene Symbol: CHCHD2
• Gene ID (NCBI): 51142
• RRID: AB_3086512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y6H1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vignesh (Verified Customer) (08-28-2025)

It's an excellent product with reduced or no nonspecific bands.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: HTB126