CHDH Polyclonal antibody

• 

  WB analysis using 17356-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17356-1-AP (CHDH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 17356-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17356-1-AP (CHDH antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 17356-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17356-1-AP (CHDH antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 17356-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17356-1-AP (CHDH antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver cancer using 17356-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17356-1-AP (CHDH antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

CHDH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17356-1-AP

Publications(7)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CDH, CHD, CHDH, Choline dehydrogenase

---

Tested Applications

• Positive WB detected in: rat liver tissue, mouse kidney tissue, mouse liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

17356-1-AP targets CHDH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10614

  Product name: Recombinant human CHDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 244-594 aa of BC034502

  Sequence: YLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR

• Full Name: choline dehydrogenase
• Calculated Molecular Weight: 594 aa, 65 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC034502
• Gene Symbol: CHDH
• Gene ID (NCBI): 55349
• RRID: AB_2276253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NE62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHDH(Choline dehydrogenase, mitochondrial) is also named as CDH,CHD and belongs to the GMC oxidoreductase family. CHDH is a member of the glucose-methanol-choline family of oxidoreductases, with each member containing a consensus FAD-binding domain. Many members of this oxidoreductase family are soluble proteins but mammalian CHDH is associated with the inner mitochondrial membrane(Handbook of vitamins,Robert B,2007). The full length protein(65 kDa) has a transit peptide of 29 amino acid and the mature CHDH is appropriately located in the inner mitochondria membrane(PMID:12951056). 17356-1-AP can also recognize the 45 kDa isoform X3 of CHDH.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Biol Chem; Betaine is accumulated via transient choline dehydrogenase activation during Mouse oocyte meiotic maturation.; Authors - Taylor McClatchie ; KO Validated
human	IHC	PLoS One; Choline dehydrogenase polymorphism rs12676 is a functional variation and is associated with changes in human sperm cell function.; Authors - Johnson Amy R AR
human	IHC	Transl Oncol; Quantitative proteomic profiling of hepatocellular carcinoma at different serum alpha-fetoprotein level.; Authors - Xuyong Wei
human	IF	Sci Adv; Maintaining hypoxia environment of subchondral bone alleviates osteoarthritis progression; Authors - Hao Zhang
human,mouse	WB,IF	Aging (Albany NY); Mitochondrial-related genes PDK2, CHDH, and ALDH5A1 served as a diagnostic signature and correlated with immune cell infiltration in ulcerative colitis; Authors - Qian Yang
human	WB	Authors -

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wojciech (Verified Customer) (03-23-2023)

A band was detected at around 60 kDa. 30 ug of protein was loaded and probed with the antibody at 1:2000 dilution.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: T-ALL cell line (CCRF-CEM)

FH

Hua (Verified Customer) (12-04-2018)

40 ug of mouse liver lysate was loaded onto the gel. The incubation time is over night at 4oC.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse liver

CHDH Antibody Western Blot, validation (1:1000 dilution) in mouse liver (Cat no:17356-1-AP)