CHGB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85438-4-RR (same clone as 85438-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85438-4-RR (CHGB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85438-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 85438-4-RR (same clone as 85438-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85438-4-RR (CHGB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85438-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 85438-4-RR (same clone as 85438-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 85438-4-RR (CHGB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85438-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 85438-4-RR (same clone as 85438-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 85438-4-RR (CHGB antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85438-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85438-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85438-4-RR against Human CHGB were performed. The affinity constant is 1.95 nM.

CHGB Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85438-4-PBS

Clone No.242952C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CgB, Chromogranin B, SCG1, 242952C9, Chromogranin-B

---

Product Information

85438-4-PBS targets CHGB in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6833

  Product name: Recombinant human CHGB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-677 aa of BC000375

  Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG

• Full Name: chromogranin B (secretogranin 1)
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 70-100 kDa
• GenBank Accession Number: BC000375
• Gene Symbol: Chromogranin B
• Gene ID (NCBI): 1114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05060
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa.