CHGB Recombinant monoclonal antibody

• 

  WB analysis using 85438-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85438-4-RR (CHGB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85438-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85438-4-RR (CHGB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas using 85438-4-RR

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 85438-4-RR (CHGB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas using 85438-4-RR

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 85438-4-RR (CHGB antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85438-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85438-4-RR against Human CHGB were performed. The affinity constant is 1.95 nM.

CHGB Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85438-4-RR

Clone No.242952C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CgB, Chromogranin B, SCG1, 242952C9, Chromogranin-B

---

Tested Applications

• Positive WB detected in: HeLa cells, BxPC-3 cells, SH-SY5Y cells, RAW 264.7 cells, PC-12 cells, HEK-293T cells
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85438-4-RR targets CHGB in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6833

  Product name: Recombinant human CHGB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-677 aa of BC000375

  Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG

• Full Name: chromogranin B (secretogranin 1)
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 70-100 kDa
• GenBank Accession Number: BC000375
• Gene Symbol: Chromogranin B
• Gene ID (NCBI): 1114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05060
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa.