CHM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHM Polyclonal antibody, PBS Only (26251-1-PBS)

• 

  WB analysis using 26251-1-AP (same clone as 26251-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26251-1-AP (CHM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse placenta using 26251-1-AP (same clone as 26251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 26251-1-AP (CHM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26251-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 26251-1-AP (same clone as 26251-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CHM antibody (26251-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 26251-1-PBS in a different storage buffer formulation.

CHM Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 26251-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Choroideraemia protein, REP1, REP 1, Rab escort protein 1, GGTA

---

Product Information

26251-1-PBS targets CHM in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23166

  Product name: Recombinant human CHM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-110 aa of BC063522

  Sequence: VSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYGRSTLLL

• Full Name: choroideremia (Rab escort protein 1)
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC063522
• Gene Symbol: CHM
• Gene ID (NCBI): 1121
• RRID: AB_3669530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24386
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHM (Choroideremia protein) is also named as Rab escort protein 1 (REP-1), TCD and Rab proteins geranylgeranyltransferase component A 1. Choroideremia (CHM) is an X-linked recessive eye disease that is caused by null mutations in REP-1, a gene involved in the regulation of Rab GTPases and intracellular vesicular transport (PMID: 9067750, PMID: 16936131). REP-1 is involved in trafficking of Rab proteins in the cell. And REP-1 binds newly synthesized Rab proteins and presents them to the catalytic site of RabGGTase (PMID: 19427510). RAB-27 in several neurons, such as motor neurons at neuromuscular junctions, requires REP-1 for normal synaptic transmission responsible for aldicarb sensitivity (PMID: 19090809). REP-1 acts as a component of the protein complex. There are two similar Rab escort proteins (75% sequence identity): REP-1 and REP-2. A 95-kDa protein (previously designated component A and now called REP-1) is present (PMID: 8294464, PMID: 17140818).