CHMP4C Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CHMP4C Recombinant monoclonal antibody (87800-1-RR)

• 

  WB analysis using 87800-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87800-1-RR (CHMP4C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of Human lung cancer （Adenocarcinoma） using 87800-1-RR

  Immunohistochemical analysis of paraffin-embedded Human lung cancer (Adenocarcinoma) slide using 87800-1-RR (CHMP4C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of Human lung cancer （Adenocarcinoma） using 87800-1-RR

  Immunohistochemical analysis of paraffin-embedded Human lung cancer (Adenocarcinoma) slide using 87800-1-RR (CHMP4C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CHMP4C Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87800-1-RR

Clone No.251884A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7 3, hSnf7-3, hVps32 3

---

Tested Applications

• Positive WB detected in: DU 145 cells, HeLa cells, NCI-H1299 cells, A549 cells, LNCap cells, SiHa cells, TT cells
• Positive IHC detected in: Human lung cancer （Adenocarcinoma）; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87800-1-RR targets CHMP4C in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9577

  Product name: Recombinant human CHMP4C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-233 aa of BC014321

  Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT

• Full Name: chromatin modifying protein 4C
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 35 -42 kDa
• GenBank Accession Number: BC014321
• Gene Symbol: CHMP4C
• Gene ID (NCBI): 92421
• RRID: AB_3745758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96CF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHMP4C (Charged multivesicular body protein 4c), also known as SHAX3. It is expected to be located in the cytoplasm and membrane, which is expressed in heart, spleen and kidney. CHMP4C is one of the charged multivesicular protein (CHMP), and is involved in the composition of the endosomal sorting complex required for transport III (ESCRT-III), facilitating the necessary separation of daughter cells. CHMP4C has been proposed to be involved in the progression of different carcinomas. The molecular weight of CHMP4C is 26 kDa. Phosphorylated at Ser-210 by AURKB during cytokinesis: together with ZFYVE19/ANCHR, phosphorylated CHMP4C retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Phosphorylation and ubiquitination modification may lead to molecular weight of 35-42kd.