CHPF N-terminal Polyclonal antibody

• 

  WB analysis of human placenta using 23953-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 23953-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C6 using 23953-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 23953-1-AP (CHPF N-terminal antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 23953-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 23953-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 23953-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CHPF N-terminal antibody (23953-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

CHPF N-terminal Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 23953-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ChPF, Chondroitin-polymerizing factor, EC:2.4.1.175, CSS2, CHSY2

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse skeletal muscle tissue, C6 cells
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

23953-1-AP targets CHPF N-terminal in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20819

  Product name: Recombinant human CHPF protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-350 aa of BC023531

  Sequence: MRASLLLSVLRPAGPVAVGISLGFTLSLLSVTWVEEPCGPGPPQPGDSELPPRGNTNAARRPNSVQPGAEREKPGAGEGAGENWEPRVLPYHPAQPGQAAKKAVRTRYISTELGIRQRLLVAVLTSQTTLPTLGVAVNRTLGHRLERVVFLTGARGRRAPPGMAVVTLGEERPIGHLHLALRHLLEQHGDDFDWFFLVPDTTYTEAHGLARLTGHLSLASAAHLYLGRPQDFIGGEPTPGRYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLGRCILDATGVGCTGDHEGVHYSHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQ

• Full Name: chondroitin polymerizing factor
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85-90 kDa, 65-70 kDa
• GenBank Accession Number: BC023531
• Gene Symbol: CHPF
• Gene ID (NCBI): 79586
• RRID: AB_2879373
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8IZ52
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cells; Targeting Chondroitin Sulfate Reduces Invasiveness of Glioma Cells by Suppressing CD44 and Integrin β1 Expression.; Authors - Yin-Hung Chu
human	IHC,WB	J Cell Commun Signal; Chondroitin polymerizing factor predicts a poor prognosis and promotes breast cancer progression via the upstream TGF-β1/SMAD3 and JNK axis activation; Authors - Qiang-Feng Pan
human	WB,IHC,IF	Aging (Albany NY); The HNF4A-CHPF pathway promotes proliferation and invasion through interactions with MAD1L1 in glioma; Authors - Haitao Luo ; KD Validated