CHPF N-terminal Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHPF N-terminal Polyclonal antibody, PBS Only (23953-1-PBS)

• 

  WB analysis of human placenta using 23953-1-AP (same clone as 23953-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 23953-1-AP (same clone as 23953-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 23953-1-AP (same clone as 23953-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 23953-1-AP (CHPF N-terminal antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 23953-1-AP (same clone as 23953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 23953-1-AP (same clone as 23953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23953-1-AP (CHPF N-terminal antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23953-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 23953-1-AP (same clone as 23953-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CHPF N-terminal antibody (23953-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 23953-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHPF N-terminal Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ChPF, Chondroitin-polymerizing factor, EC:2.4.1.175, CSS2, CHSY2

---

Product Information

23953-1-PBS targets CHPF N-terminal in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20819

  Product name: Recombinant human CHPF protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-350 aa of BC023531

  Sequence: MRASLLLSVLRPAGPVAVGISLGFTLSLLSVTWVEEPCGPGPPQPGDSELPPRGNTNAARRPNSVQPGAEREKPGAGEGAGENWEPRVLPYHPAQPGQAAKKAVRTRYISTELGIRQRLLVAVLTSQTTLPTLGVAVNRTLGHRLERVVFLTGARGRRAPPGMAVVTLGEERPIGHLHLALRHLLEQHGDDFDWFFLVPDTTYTEAHGLARLTGHLSLASAAHLYLGRPQDFIGGEPTPGRYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLGRCILDATGVGCTGDHEGVHYSHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQ

• Full Name: chondroitin polymerizing factor
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 85-90 kDa, 65-70 kDa
• GenBank Accession Number: BC023531
• Gene Symbol: CHPF
• Gene ID (NCBI): 79586
• RRID: AB_2879373
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8IZ52
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.