CHRNA6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHRNA6 Polyclonal antibody, PBS Only (11388-1-PBS)

• 

  WB analysis of mouse thymus using 11388-1-AP (same clone as 11388-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11388-1-AP (CHRNA6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11388-1-PBS in a different storage buffer formulation.

CHRNA6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11388-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11388-1-PBS targets CHRNA6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1921

  Product name: Recombinant human CHRNA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-250 aa of BC014456

  Sequence: MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIP

• Full Name: cholinergic receptor, nicotinic, alpha 6
• Calculated Molecular Weight: 494 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC014456
• Gene Symbol: CHRNA6
• Gene ID (NCBI): 8973
• RRID: AB_2080683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15825
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.