CHRNA7 Monoclonal antibody

• 

  WB analysis of MCF-7 using 60220-1-Ig

  MCF7 cells were subjected to SDS PAGE followed by western blot with 60220-1-Ig (CHRNA7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 60220-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60220-1-Ig (CHRNA7 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 60220-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60220-1-Ig (CHRNA7 Antibody) at dilution of 1:200 (under 40x lens).

CHRNA7 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60220-1-Ig

Clone No.2H1G3

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CHRNA7, CHRNA7 2, NACHRA7

---

Tested Applications

• Positive WB detected in: MCF7 cells
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

60220-1-Ig targets CHRNA7 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15980

  Product name: Recombinant human CHRNA7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 130-321 aa of BC037571

  Sequence: TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

• Full Name: cholinergic receptor, nicotinic, alpha 7
• Calculated Molecular Weight: 502 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC037571
• Gene Symbol: CHRNA7
• Gene ID (NCBI): 1139
• RRID: AB_11043180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36544
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nicotinic acetylcholine receptors (nAChRs) are cholinergic receptors that form ligand-gated ion channels that mediate fast signal transmission at synapses. CHRNA7 (neuronal acetylcholine receptor subunit alpha-7) forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Functional Human α7 Nicotinic Acetylcholine Receptor (nAChR) Generated from E. coli.; Authors - Tommy S Tillman