• Featured Product
  • KD/KO Validated

CHRNA7 (48 kDa) Recombinant monoclonal antibody, PBS Only

CHRNA7 (48 kDa) Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 82848-3-PBS
Clone No.2A10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

CHRNA7, Neuronal acetylcholine receptor subunit alpha-7, NACHRA7, CHRNA7 2, 2A10

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82848-3-PBS targets CHRNA7 (48 kDa) in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15980

Product name: Recombinant human CHRNA7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 130-321 aa of BC037571

Sequence: TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

Predict reactive species
Full Name cholinergic receptor, nicotinic, alpha 7
Calculated Molecular Weight 502 aa, 56 kDa
Observed Molecular Weight~50 kDa
GenBank Accession NumberBC037571
Gene Symbol CHRNA7
Gene ID (NCBI) 1139
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36544
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nicotinic acetylcholine receptors (nAChRs) are cholinergic receptors that form ligand-gated ion channels that mediate fast signal transmission at synapses. CHRNA7 (neuronal acetylcholine receptor subunit alpha-7) forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. CHRNA7, so that like CHRNA7, the epithelial CHRFAM7A ORF encodes a protein (48 kDa) that differs from the CHRNA7 (58 kDa) by a distinct amino terminus and molecular weight.(PMID: 25473097)

Loading...
||
New chat Able
正在加载,请稍候...