CHRNA9 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CHRNA9 Recombinant monoclonal antibody, PBS Only (87585-1-PBS)

CHRNA9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87585-1-PBS

Clone No.252931C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

HSA243342, NACHR alpha 9, NACHR alpha-9, NACHRA9, Neuronal acetylcholine receptor subunit alpha-9

• 

  WB analysis using 87585-1-RR (same clone as 87585-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87585-1-RR (CHRNA9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87585-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 87585-1-RR (same clone as 87585-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 87585-1-RR (CHRNA9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87585-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87585-1-PBS targets CHRNA9 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23272

  Product name: Recombinant human CHRNA9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 324-479 aa of BC113549

  Sequence: HFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATSSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD

• Full Name: cholinergic receptor, nicotinic, alpha 9
• Calculated Molecular Weight: 479 aa, 55 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC113549
• Gene Symbol: CHRNA9
• Gene ID (NCBI): 55584
• RRID: AB_3745638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UGM1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHRNA9 (nicotinic α9 subunit of cholinergic receptor) gene is located in zone 4 (4p14) of short arm 1 of human chromosome 4, encoding a ligand-gated divalent cation channel protein, belonging to the nicotinic acetylcholine receptor (nAChR) superfamily. This subunit can be combined with CHRNA10 subunit to form a heteropentamer or a homopentamer, which is mainly distributed in cochlear outer hair cells, dorsal root ganglion, keratinocytes and immune cells.