Tested Applications
| Positive WB detected in | human liver tissue, mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11553-1-AP targets CHRNB1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2108 Product name: Recombinant human CHRNB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-501 aa of BC023553 Sequence: CSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP Predict reactive species |
| Full Name | cholinergic receptor, nicotinic, beta 1 (muscle) |
| Calculated Molecular Weight | 501 aa, 57 kDa |
| Observed Molecular Weight | 50-57 kDa |
| GenBank Accession Number | BC023553 |
| Gene Symbol | CHRNB1 |
| Gene ID (NCBI) | 1140 |
| RRID | AB_2291854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11230 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Acetylcholine receptors (AChRs) are integral membrane proteins that respond to the binding of acetylcholine (ACh), a neurotransmitter synthesized, stored and finally released by cholinergic neurons. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one each of the beta, delta, and gamma (in immature muscle) or epsilon (in mature muscle) subunits. CHRNB1 gene encodes acetylcholine receptor subunit beta (ACHRB). Mutations in this gene are associated with slow-channel congenital myasthenic syndrome.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CHRNB1 antibody 11553-1-AP | Download protocol |
| IP protocol for CHRNB1 antibody 11553-1-AP | Download protocol |
| WB protocol for CHRNB1 antibody 11553-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CHRNB1 Polyclonal antibody (Cat# 11553-1-AP) has 9 citations published in journals including Nature Communications, Translational Psychiatry, Molecular Therapy Nucleic Acids, Cell and Molecular Life Sciences, Aging, Genes and Immunity, PLoS One, and Biochemical and Biophysical Research Communications. Research fields span neuroscience (cholinergic signaling, radial glia development, neuromuscular junction), gut-brain axis, lung adenocarcinoma, T-cell immunology, and myasthenia gravis.
| Species | Application | Title |
|---|---|---|
Nat Commun α7 nicotinic acetylcholine receptors regulate radial glia fate in the developing human cortex. | ||
Transl Psychiatry A diet high in sugar and fat influences neurotransmitter metabolism and then affects brain function by altering the gut microbiota. | ||
Cell Mol Life Sci The miR-206-3p/Cpeb1 axis delays acetylcholine receptor degradation and preserves neuromuscular junction stability in denervation-induced muscle atrophy. | ||
Mol Ther Nucleic Acids MiR-142a-3p: A novel ACh receptor transcriptional regulator in association with peripheral nerve injury | ||
Aging (Albany NY) Maternal high sugar and fat diet benefits offspring brain function via targeting on the gut-brain axis. | ||
Aging (Albany NY) A five-m6A regulatory gene signature is a prognostic biomarker in lung adenocarcinoma patients. |







