CHRNG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHRNG Polyclonal antibody, PBS Only (21928-1-PBS)

• 

  WB analysis using 21928-1-AP (same clone as 21928-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21928-1-AP (CHRNG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21928-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21928-1-AP (same clone as 21928-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21928-1-AP (CHRNG antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21928-1-PBS in a different storage buffer formulation.

CHRNG Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21928-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ACHRG, Acetylcholine receptor subunit gamma

---

Product Information

21928-1-PBS targets CHRNG in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16505

  Product name: Recombinant human CHRNG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 279-422 aa of BC111802

  Sequence: LRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDR

• Full Name: cholinergic receptor, nicotinic, gamma
• Calculated Molecular Weight: 465 aa, 52 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC111802
• Gene Symbol: CHRNG
• Gene ID (NCBI): 1146
• RRID: AB_3085678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07510
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Acetylcholine receptor subunit gamma is a protein that in humans is encoded by the CHRNG gene. The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis.