CHSY3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHSY3 Polyclonal antibody, PBS Only (24444-1-PBS)

• 

  WB analysis using 24444-1-AP (same clone as 24444-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24444-1-AP (CHSY3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24444-1-PBS in a different storage buffer formulation.

CHSY3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24444-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Carbohydrate synthase 2, chondroitin sulfate synthase 3, Chondroitin synthase 2, ChSy 2, CHSY2

---

Product Information

24444-1-PBS targets CHSY3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19641

  Product name: Recombinant human CHSY3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 571-769 aa of BC137325

  Sequence: FFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFS

• Full Name: chondroitin sulfate synthase 3
• Calculated Molecular Weight: 882 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC137325
• Gene Symbol: CHSY3
• Gene ID (NCBI): 337876
• RRID: AB_3742114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q70JA7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHSY3 is a Golgi-localized chondroitin sulfate synthase that controls glycosaminoglycan chain elongation on extracellular matrix proteoglycans. By regulating chondroitin sulfate structure, CHSY3 influences matrix organization, growth factor signaling, and tissue mechanics. Its dysregulation is implicated in cartilage pathology, pulmonary remodeling, and cancer progression, highlighting CHSY3 as a key enzymatic regulator of extracellular matrix biology.