Filter:
Tested Applications
| Positive WB detected in | MCF-7 cells, MDA-MB-231 cells, MKN-45 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33030-1-AP targets CHTF8 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag39083 Product name: Recombinant human CHTF8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC018700 Sequence: MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV Predict reactive species |
| Full Name | CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC018700 |
| Gene Symbol | CHTF8 |
| Gene ID (NCBI) | 54921 |
| RRID | AB_3742827 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P0CG13 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHTF8 (C-terminal binding protein Transcriptional co-Factor 8) is a crucial protein that serves as a core component of the chromatin assembly factor-1 (CAF-1) complex.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CHTF8 antibody 33030-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
