CIDEB Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CIDEB Recombinant monoclonal antibody, PBS Only (88087-1-PBS)

• 

  WB analysis using 88087-1-RR (same clone as 88087-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88087-1-RR (CIDEB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88087-1-PBS in a different storage buffer formulation.

CIDEB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88087-1-PBS

Clone No.260294B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Cell death activator CIDE B, Cell death activator CIDE-B, Cell death-inducing DFFA-like effector B

---

Product Information

88087-1-PBS targets CIDEB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27003

  Product name: Recombinant human CIDEB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-179 aa of BC035970

  Sequence: RVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELL

• Full Name: cell death-inducing DFFA-like effector b
• Calculated Molecular Weight: 219 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC035970
• Gene Symbol: CIDEB
• Gene ID (NCBI): 27141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHD4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cell death‐inducing DFFA‐like effector B (CIDEB), an ER and lipid droplet (LD)‐associated protein primarily expressed in the liver, participated in lipid metabolism by regulating lipid droplet fusion and VLDL lipidation. Although CIDEA is expressed at high levels in brown adipose tissue (BAT) and CIDEC is highly enriched in white adipose tissue (WAT) and BAT, CIDEB is more abundant in liver, kidney, small intestine, and colon. CIDEB is localized to endoplasmic reticulum and lipid droplets. (PMID: 30858281, PMID: 24831470, PMID: 19187774)