CIDEB Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CIDEB Recombinant monoclonal antibody (88087-1-RR)

• 

  WB analysis using 88087-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88087-1-RR (CIDEB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

CIDEB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88087-1-RR

Clone No.260294B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cell death activator CIDE B, Cell death activator CIDE-B, Cell death-inducing DFFA-like effector B

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, L02 cells, HuH-7 cells, HepG2 cells, RAW 264.7 cells, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88087-1-RR targets CIDEB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27003

  Product name: Recombinant human CIDEB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-179 aa of BC035970

  Sequence: RVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELL

• Full Name: cell death-inducing DFFA-like effector b
• Calculated Molecular Weight: 219 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC035970
• Gene Symbol: CIDEB
• Gene ID (NCBI): 27141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHD4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell death‐inducing DFFA‐like effector B (CIDEB), an ER and lipid droplet (LD)‐associated protein primarily expressed in the liver, participated in lipid metabolism by regulating lipid droplet fusion and VLDL lipidation. Although CIDEA is expressed at high levels in brown adipose tissue (BAT) and CIDEC is highly enriched in white adipose tissue (WAT) and BAT, CIDEB is more abundant in liver, kidney, small intestine, and colon. CIDEB is localized to endoplasmic reticulum and lipid droplets. (PMID: 30858281, PMID: 24831470, PMID: 19187774)