CILP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CILP2 Polyclonal antibody, PBS Only (11813-1-PBS)

• 

  WB analysis using 11813-1-AP (same clone as 11813-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11813-1-AP (CILP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11813-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 11813-1-AP (same clone as 11813-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 11813-1-AP (CILP2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11813-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 11813-1-AP (same clone as 11813-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CILP2 antibody (11813-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11813-1-PBS in a different storage buffer formulation.

CILP2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 11813-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CILP-2, Cartilage intermediate layer protein 2 C2, Cartilage intermediate layer protein 2 C1

---

Product Information

11813-1-PBS targets CILP2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2366

  Product name: Recombinant human CILP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 304-653 aa of BC034926

  Sequence: ALVTATLGGEELEPAPSLPRPLPATVGVTQPYLDRLGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFARVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGGSHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRRVAVNGLLRDYLTRHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEAAQAQARASGPLRTRRGRVRQ

• Full Name: cartilage intermediate layer protein 2
• Calculated Molecular Weight: 126 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC034926
• Gene Symbol: CILP2
• Gene ID (NCBI): 148113
• RRID: AB_2877795
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUL8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CILP2, also named as Cartilage intermediate layer protein 2, is a 1156 amino acid protein, which is expressed in articular chondrocytes but not in knee meniscal cartilage cells. CILP2 localizes to the intermediate to deep zone of articular cartilage. CILP2 may play a role in cartilage scaffolding. Given the full-length molecular mass of CILP2 is 125 kDa, but the most CILP2 protein in articular cartilage is cleaved,mostly likely at the furin cleavage site. CILP2 protein is detected as a major band on SDS-page migrating at about 90 kDa. (PMID: 21880736)