CIMIP2C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CIMIP2C Polyclonal antibody (33446-1-AP)

• 

  WB analysis using 33446-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33446-1-AP (CIMIP2C antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

CIMIP2C Polyclonal Antibody for WB, ELISA

Cat No. 33446-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C2orf70, Ciliary microtubule inner protein 2C, FAM166C

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse spermatophore tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33446-1-AP targets CIMIP2C in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37807

  Product name: Recombinant human CIMIP2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of NM_001105519

  Sequence: MASRSAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGGHFPTIFSTNPNLLLMERASTRDRWLHKPSYTRFNLDSHRSTELTNFYQMVQQHRKYYQDKTGTVPRVPYFAMPVREPERYPLPTVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA

• Full Name: chromosome 2 open reading frame 70
• Calculated Molecular Weight: 201aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: NM_001105519
• Gene Symbol: C2orf70
• Gene ID (NCBI): 339778
• RRID: AB_3742972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A6NJV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CIMIP2C (ciliary microtubule inner protein 2C), also known as C2orf70, FAM166C, encodes a microtubule inner protein (MIP) that is an integral component of the dynein-decorated doublet microtubules (DMTs) within the axoneme of motile cilia. CIMIP2C shows biased expression in the testis, consistent with its role in flagellated sperm motility (PMID: 37989994).