CISD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CISD1 Polyclonal antibody, PBS Only (16006-1-PBS)

• 

  WB analysis using 16006-1-AP (same clone as 16006-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16006-1-AP (CISD1 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16006-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 16006-1-AP (same clone as 16006-1-PBS)

  IP result of anti-CISD1 (IP:16006-1-AP, 3ug; Detection:16006-1-AP 1:2000) with HepG2 cells lysate 600ug. This data was developed using the same antibody clone with 16006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 16006-1-AP (same clone as 16006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 16006-1-AP (CISD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16006-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16006-1-AP (same clone as 16006-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CISD1 antibody (16006-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 16006-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CISD1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16006-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1, EC:2.6.1.3

---

Product Information

16006-1-PBS targets CISD1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8680

  Product name: Recombinant human mitoNEET,CISD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC007043

  Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

• Full Name: CDGSH iron sulfur domain 1
• Calculated Molecular Weight: 108 aa, 12 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC007043
• Gene Symbol: CISD1
• Gene ID (NCBI): 55847
• RRID: AB_2080268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ45
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.