CITED2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CITED2 Polyclonal antibody, PBS Only (15021-1-PBS)

• 

  WB analysis of SH-SY5Y using 15021-1-AP (same clone as 15021-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 15021-1-AP (CITED2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15021-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 15021-1-AP (same clone as 15021-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15021-1-AP (CITED2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15021-1-AP (same clone as 15021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15021-1-AP (CITED2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15021-1-AP (same clone as 15021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15021-1-AP (CITED2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 15021-1-AP (same clone as 15021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 15021-1-AP (CITED2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15021-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 15021-1-AP (same clone as 15021-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed SH-SY5Y cells using 15021-1-AP (CITED2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15021-1-PBS in a different storage buffer formulation.

CITED2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15021-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MSG-related protein 1, MSG related protein 1, MRG-1, MRG1, MRG 1

---

Product Information

15021-1-PBS targets CITED2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7078

  Product name: Recombinant human CITED2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC004377

  Sequence: MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC

• Full Name: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 36 kDa, 27 kDa
• GenBank Accession Number: BC004377
• Gene Symbol: CITED2
• Gene ID (NCBI): 10370
• RRID: AB_2080545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99967
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CITED2, also named as P35srj, is a cAMP-responsive element-binding protein (CBP)/p300-transactivator, with an ED(Glu/Asp)-rich C-terminal domain that acts as an important modulator in the development of the heart [PMID:10552932]. There are two isoforms of CITED2 protein and the calculated molecular weight of them are 24kDa and 28 kDa. The 28 kDa isoform having modification site may migrate to 35 kDa and 24 kDa isoform having modification site may migrate to 27 kDa (PMID: 23082118). It is proposed to be a negative regulator of HIF-1α through its competitive binding to the CH1 domain of CBP/p300, which mediated signaling and to a decrease in HIF-1-responsive genes such as VEGF [PMID:9887100]. In addition, it is also a co-activator of the transcriptional activity of the TFAP2 isoform, which is an extensively expressed nuclear protein with functions in embryogenesis, inflammation, and stress responses[PMID:22735262].