CKAP4 Recombinant monoclonal antibody, PBS Only

CKAP4 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84485-5-PBS
Clone No.241871C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

241871C5, 63 kDa membrane protein, CLIMP 63, Climp-63, ERGIC 63

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84485-5-PBS targets CKAP4 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10022

Product name: Recombinant human CKAP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 254-602 aa of BC082972

Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV

Predict reactive species
Full Name cytoskeleton-associated protein 4
Calculated Molecular Weight 602 aa, 66 kDa
Observed Molecular Weight 63 kDa
GenBank Accession NumberBC082972
Gene Symbol CKAP4
Gene ID (NCBI) 10970
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07065
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CKAP4 (Cytoskeleton-associated protein 4), also known as CLIMP-63 (cytoskeleton-linking membrane protein 63), is a 63 kDa cytoskeleton-linking membrane protein. CKAP4 is a novel DKK1-binding protein on the cell surface membrane of Madin-Darby canine kidney (MDCK) epithelial cells, and evaluated CKAP4-mediated DKK1 signaling in cancer cell proliferation (PMID: 27322059). In addition, CKAP4 was modified with palmitate at Cys100 by palmitoyl acyltransferase DHHC2 (PMID: 18296695), and palmitoylation was required for CKAP4 localization to PM lipid rafts to promote cancer cell proliferation (PMID: 31744930).

Loading...
||
New chat Able
正在加载,请稍候...