Ch-TOG Recombinant monoclonal antibody, PBS Only (Detector)

Ch-TOG Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84285-3-PBS
Clone No.241546G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

CKAP5, 241546G8, ch TOG, Colonic and hepatic tumor overexpressed gene protein, Cytoskeleton-associated protein 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84285-3-PBS targets Ch-TOG as part of a matched antibody pair:

MP01203-1: 84285-1-PBS capture and 84285-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24875

Product name: Recombinant human CKAP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-349 aa of BC120869

Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV

Predict reactive species
Full Name cytoskeleton associated protein 5
Observed Molecular Weight 220 kDa
GenBank Accession NumberBC120869
Gene Symbol Ch-TOG
Gene ID (NCBI) 9793
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14008
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles.

Loading...
||
New chat Able
正在加载,请稍候...