CLCA1 Recombinant monoclonal antibody

CLCA1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 83829-7-RR
Clone No.240941G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Calcium-activated chloride channel protein 1, Calcium-activated chloride channel family member 1, CaCC-1, CACC1, CACC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83829-7-RR targets CLCA1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18176

Product name: Recombinant human CLCA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 715-914 aa of BC156805

Sequence: EINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDLFIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILKIMWKWIGELQLSIA

Predict reactive species
Full Name chloride channel accessory 1
Calculated Molecular Weight 914 aa, 100 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC156805
Gene Symbol CLCA1
Gene ID (NCBI) 1179
RRIDAB_3671413
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDA8K7I4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcium-activated chloride channel regulator 1(CLCA1) is a secreted protein, and it has an N-terminal zinc-dependent metallohydrolase domain with a conserved HExxE catalytic motif similar to that found in matrix metalloproteases (MMPs), and "a Disintegrin and metalloproteases" (ADAMs). The only known substrate for CLCA1 is CLCA1 itself as it undergoes intracellular autocatalytic cleavage resulting in two cleavage products which are both secreted. Since a previous study suggested that a band around 75 kDa, corresponding to the N-terminal autocatalytic cleavage product, was observed in mucus from both human and WT mice. In addition, an additional band at 50 kDa was identified in human and WT mouse mucus, suggesting that CLCA1 can be further processed. However, no band corresponding to the full-length un-cleaved CLCA1 could be detected in the human samples, and only a very faint band was observed in WT mouse mucus, indicating that most of the CLCA1 that is secreted into the mucus is fully cleaved in vivo. (PMID: 29885864)

Protocols

Product Specific Protocols
WB protocol for CLCA1 antibody 83829-7-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...