Claudin 2 Polyclonal antibody

• 

  WB analysis of HepG2 using 11291-2-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11291-2-AP (Claudin 2 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

Claudin 2 Polyclonal Antibody for WB, ELISA

Cat No. 11291-2-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

claudin 2, CLDN2, SP82, UNQ705/PRO1356

---

Tested Applications

• Positive WB detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 3 publications below

Product Information

11291-2-AP targets Claudin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1866

  Product name: Recombinant human CLDN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC014424

  Sequence: MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

• Full Name: claudin 2
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC014424
• Gene Symbol: Claudin 2
• Gene ID (NCBI): 9075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57739
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Front Pharmacol; Polysaccharide, the Active Component of Dendrobium officinale, Ameliorates Metabolic Hypertension in Rats via Regulating Intestinal Flora-SCFAs-Vascular Axis.; Authors - Bo Li
mouse	IHC	Molecules; Effect and Mechanism of Pharmaceutical Excipients on Berberine to Alleviate Ulcerative Colitis via Regulating Gut Microbiota; Authors - Chenyang Wu
bovine	WB	Animals (Basel); Nicotinamide Supplementation Mitigates Oxidative Injury of Bovine Intestinal Epithelial Cells through Autophagy Modulation; Authors - Yihan Guo
mouse	IHC	J Periodontal Res; The effect of Porphyromonas gingivalis on the gut microbiome of mice in relation to aging; Authors - Sarita Giri
mouse	WB,IHC	J Oral Biosci; Oral infection with Porphyromonas gingivalis augmented gingival epithelial barrier molecules alteration with aging; Authors - Sarita Giri