FITC Plus Anti-Human CLEC10A/CD301 Rabbit Recombinant Antibody

CLEC10A/CD301 Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98245
Clone No.241857C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CLEC10A, 241857C11, CD301, CLECSF13, CLECSF14

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inHuman immature monocyte-derived dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98245 targets CLEC10A/CD301 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1892

Product name: Recombinant Human CLEC10A/CD301 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 61-316 aa of BC039011

Sequence: QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Predict reactive species
Full Name C-type lectin domain family 10, member A
Calculated Molecular Weight 316 aa, 35 kDa
GenBank Accession NumberBC039011
Gene Symbol CLEC10A
Gene ID (NCBI) 10462
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IUN9
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

C-type lectin domain family 10 member A (CLEC10A), also known as CD301, macrophage galactose-type C-type lectin (MGL), DC-asialoglyco protein receptor (DC-ASGP-R) or human macrophage lectin (HML), is a type II transmembrane glycoprotein having a calcium-dependent carbohydrate recognition domain (PMID: 8598452; 11919201; 11698450). CLEC10A is expressed exclusively by myeloid professional antigen-presenting cells such as immature dendritic cells (DCs) and alternatively activated macrophages (PMID: 16998493). CLEC10A is a marker for human CD1c+ DCs (cDC2) (PMID: 29755453). It functions as an endocytic receptor for glycosylated antigens (PMID: 11919201).

Protocols

Product Specific Protocols
FC protocol for FITC Plus CLEC10A/CD301 antibody FITC-98245Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...