SCGF Monoclonal antibody

SCGF Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 60295-1-Ig
Clone No.4H11E4

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

CLEC11A, 4H11E4, LSLCL, C-type lectin superfamily member 3, C-type lectin domain family 11 member A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, human heart tissue, Kasumi-1 cells
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lymphoma tissue, HepG2 cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60295-1-Ig targets SCGF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21365

Product name: Recombinant human CLEC11A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 19-323 aa of BC005810

Sequence: GHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF

Predict reactive species
Full Name C-type lectin domain family 11, member A
Calculated Molecular Weight 36 kDa
Observed Molecular Weight36-40 kDa
GenBank Accession NumberBC005810
Gene Symbol SCGF
Gene ID (NCBI) 6320
RRIDAB_2881410
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y240
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLEC11A, also named as CLECSF3, LSLCL, SCGF and p47, stimulates the proliferation and differentiation of hematopoietic precursor cells from various lineages, including erythrocytes, lymphocytes, granulocytes and macrophages. CLEC11A acts synergistically with other cytokines, including IL-3, GCSF, GMCSF and FLT3 ligand. It suppresses SCF-stimulated erythrocyte proliferation.

Protocols

Product Specific Protocols
IF protocol for SCGF antibody 60295-1-IgDownload protocol
IHC protocol for SCGF antibody 60295-1-IgDownload protocol
WB protocol for SCGF antibody 60295-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC, IF

FASEB J

The "Matrisome" reveals the characterization of skin keloid microenvironment.

Authors - Shikun Zhang
mouseWB

Stem Cell Rev Rep

Daidzein Activates Akt Pathway to Promote the Proliferation of Female Germline Stem Cells through Upregulating Clec11a.

Authors - Fangfang Li
humanWB

Biomol Biomed

CLEC11A expression as a prognostic biomarker in correlation to immune cells of gastric cancer

Authors - Weidan Fang
Loading...
||
New chat Able
正在加载,请稍候...