CLEC1A Polyclonal antibody

• 

  WB analysis using 13394-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13394-1-AP (CLEC1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 13394-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13394-1-AP (CLEC1A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 13394-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13394-1-AP (CLEC1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 13394-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13394-1-AP (CLEC1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 13394-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13394-1-AP (CLEC1A antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung cancer using 13394-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 13394-1-AP (CLEC1A antibody) at dilution of 1:100 (under 10x lens).

CLEC1A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13394-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

C type lectin like receptor 1, CLEC 1, CLEC1, CLEC1A

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse thymus tissue, rat lung tissue
• Positive IHC detected in: mouse lung tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

13394-1-AP targets CLEC1A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4058

  Product name: Recombinant human CLEC1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 74-280 aa of BC039072

  Sequence: QYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

• Full Name: C-type lectin domain family 1, member A
• Calculated Molecular Weight: 280 aa, 32 kDa
• Observed Molecular Weight: 50 kDa, 32 kDa
• GenBank Accession Number: BC039072
• Gene Symbol: CLEC1A
• Gene ID (NCBI): 51267
• RRID: AB_2083443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NC01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLEC1A (C-type lectin domain family 1 member A) is a single-pass type II membrane protein that contains one C-type lectin domain. Members of the C-type lectin domain family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC1A is expressed preferentially in dendritic cells and plays a role in regulating dendritic cell function (PMID: 10671229).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		EMBO Mol Med; Histidine-rich glycoprotein modulates neutrophils and thrombolysis-associated hemorrhagic transformation; Authors - Wei Jiang
mouse,human	IF	Invest Ophthalmol Vis Sci; CLEC-1 Acts as a Negative Regulator of Dectin-1 Induced Host Inflammatory Response Signature in Aspergillus fumigatus Keratitis.; Authors - Guoqiang Zhu