CLEC3A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CLEC3A Polyclonal antibody (21262-1-AP)

• 

  WB analysis using 21262-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21262-1-AP (CLEC3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CLEC3A Polyclonal Antibody for WB, ELISA

Cat No. 21262-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CLEC, CLEC3, CLECSF1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21262-1-AP targets CLEC3A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15667

  Product name: Recombinant human CLEC3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-197 aa of BC104415

  Sequence: MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ

• Full Name: C-type lectin domain family 3, member A
• Calculated Molecular Weight: 197 aa, 22 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC104415
• Gene Symbol: CLEC3A
• Gene ID (NCBI): 10143
• RRID: AB_3742025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75596
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLEC3A (C-type lectin domain family 3 member A), also known as tetranectin-like protein or cartilage-derived C-type lectin, is a secreted glycoprotein belonging to the C-type lectin superfamily. It is encoded by the human gene CLEC3A (Gene ID: 10143, located at 16q22.1) and shares structural homology with tetranectin (CLEC3B). (PMID: 29146595)