CLIC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CLIC1 Polyclonal antibody, PBS Only (14545-1-PBS)

• 

  WB analysis of HL-60 using 14545-1-AP (same clone as 14545-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14545-1-AP (CLIC1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14545-1-AP (same clone as 14545-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14545-1-AP (CLIC1 Antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 14545-1-AP (same clone as 14545-1-PBS)

  IP result of anti-CLIC1 (IP:14545-1-AP, 4ug; Detection:14545-1-AP 1:300) with HeLa cells lysate 1200ug. This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 14545-1-AP (same clone as 14545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 14545-1-AP (CLIC1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 14545-1-AP (same clone as 14545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14545-1-AP (CLIC1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 14545-1-AP (same clone as 14545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14545-1-AP (CLIC1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 14545-1-AP (same clone as 14545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 14545-1-AP (CLIC1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 14545-1-AP (same clone as 14545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14545-1-AP (CLIC1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 14545-1-AP (same clone as 14545-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14545-1-AP (CLIC1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14545-1-AP (same clone as 14545-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CLIC1 antibody (14545-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14545-1-AP (same clone as 14545-1-PBS)

  Immunofluorescent analysis of Hela cells, using CLIC1 antibody 14545-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 14545-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CLIC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14545-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

G6, NCC27

---

Product Information

14545-1-PBS targets CLIC1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6049

  Product name: Recombinant human CLIC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-241 aa of BC064527

  Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

• Full Name: chloride intracellular channel 1
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-32 kDa
• GenBank Accession Number: BC064527
• Gene Symbol: CLIC1
• Gene ID (NCBI): 1192
• RRID: AB_2081809
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00299
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chloride intracellular channel protein 1 (CLIC1) is a member of the chloride intracellular channel protein family. It plays a crucial role in various cellular processes, including the regulation of chloride ion transport, cell viability, and mitochondrial function. CLIC1 is involved in the formation of membrane-inserted channels that facilitate chloride ion movement, which is essential for maintaining cellular homeostasis and function (PMID: 32116799). Additionally, CLIC1 has been implicated in cancer progression, where it influences cell proliferation, migration, and invasion (PMID: 38027011).