CLIC2 Recombinant monoclonal antibody

• 

  WB analysis of K-562 using 83730-3-RR

  K-562 cells were subjected to SDS PAGE followed by western blot with 83730-3-RR (CLIC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83730-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83730-3-RR (CLIC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83730-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83730-3-RR against Human CLIC2 were performed. The affinity constant is below 1 pM.

CLIC2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83730-3-RR

Clone No.240726D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

XAP121, 240726D1

---

Tested Applications

• Positive WB detected in: human testis tissue, K-562 cells, human heart tissue, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83730-3-RR targets CLIC2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6766

  Product name: Recombinant human CLIC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC005367

  Sequence: MILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

• Full Name: chloride intracellular channel 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC005367
• Gene Symbol: CLIC2
• Gene ID (NCBI): 1193
• RRID: AB_3671329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15247
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLIC2 (chloride intracellular channel 2), also known as CLCNL2. It is expected to be located in cytoplasm and membrane. CLIC-2 exists as a monomer. It also has an unusual enzyme activity profile. While the CXXC active site motif is conserved between CLIC-2 and the glutaredoxins, no thiol transferase activity was detected. In contrast, low glutathione peroxidase activity was recorded. CLIC-2 was found to be widely distributed in tissues including heart and skeletal muscle. Functional studies showed that CLIC-2 inhibited cardiac ryanodine receptor Ca2+ release channels in lipid bilayers when added to the cytoplasmic side of the channels and inhibited Ca2+ release from cardiac sarcoplasmic reticulum vesicles. The calculated molecular weight of CLIC2 is 28 kDa.