Use Able AI chat for product recommendations

CLIC2 Recombinant monoclonal antibody, PBS Only (Detector)

CLIC2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83730-3-PBS
Clone No.240726D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

XAP121, 240726D1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83730-3-PBS targets CLIC2 as part of a matched antibody pair:

MP00715-1: 83730-1-PBS capture and 83730-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6766

Product name: Recombinant human CLIC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-210 aa of BC005367

Sequence: MILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

Predict reactive species
Full Name chloride intracellular channel 2
Calculated Molecular Weight 28 kDa
GenBank Accession NumberBC005367
Gene Symbol CLIC2
Gene ID (NCBI) 1193
RRIDAB_3671329
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15247
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CLIC2 (chloride intracellular channel 2), also known as CLCNL2. It is expected to be located in cytoplasm and membrane. CLIC-2 exists as a monomer. It also has an unusual enzyme activity profile. While the CXXC active site motif is conserved between CLIC-2 and the glutaredoxins, no thiol transferase activity was detected. In contrast, low glutathione peroxidase activity was recorded. CLIC-2 was found to be widely distributed in tissues including heart and skeletal muscle. Functional studies showed that CLIC-2 inhibited cardiac ryanodine receptor Ca2+ release channels in lipid bilayers when added to the cytoplasmic side of the channels and inhibited Ca2+ release from cardiac sarcoplasmic reticulum vesicles. The calculated molecular weight of CLIC2 is 28 kDa.

Loading...
||
New chat

Able™

正在加载,请稍候...