• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CLIC4 Monoclonal antibody

CLIC4 Monoclonal Antibody for
Cat No. CL488-66343
Clone No.1B7F9

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rat

Applications

CLIC4, CLIC4L, DKFZp566G223, FLJ38640, H1, huH1, MTCLIC, p64H1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66343 targets CLIC4 in applications and shows reactivity with human, pig, rat samples.

Tested Reactivity human, pig, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2942

Product name: Recombinant human CLIC4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-253 aa of BC012444

Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Predict reactive species
Full Name chloride intracellular channel 4
Calculated Molecular Weight 253 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC012444
Gene Symbol CLIC4
Gene ID (NCBI) 25932
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y696
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIC4 is a p53- and tumor necrosis factor alpha-regulated cytoplasmic and mitochondrial protein that belongs to the CLIC family of intracellular chloride channels. CLICs have actions distinct from traditional cell membrane chloride channels, including formation of ion channels in intracellular organelles and roles in membrane trafficking, apoptosis, and cell differentiation.

Loading...
||
New chat

Able

正在加载,请稍候...