CLK1 Polyclonal antibody

• 

  WB analysis using 20439-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 20439-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of HeLa using 20439-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 20439-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20439-1-AP (CLK1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of COLO 320 using 20439-1-AP

  IP result of anti-CLK1 (IP:20439-1-AP, 4ug; Detection:20439-1-AP 1:300) with COLO 320 cells lysate 2000ug.

CLK1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 20439-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CDC-like kinase 1, CLK, EC:2.7.12.1, STY

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HeLa cells, HepG2 cells
• Positive IP detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

20439-1-AP targets CLK1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14214

  Product name: Recombinant human CLK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-143 aa of BC031549

  Sequence: MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVED

• Full Name: CDC-like kinase 1
• Calculated Molecular Weight: 484 aa, 57 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC031549
• Gene Symbol: CLK1
• Gene ID (NCBI): 1195
• RRID: AB_2878686
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49759
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLK1 (CDC-like kinase 1) is the dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. It phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. It can phosphorylate: SRSF1, SRSF3 and PTPN1 (PMID: 10480872; 19168442). It also regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells (PMID: 19168442). Elevated CLK1 activity is frequently detected in cancers, where it alters splice isoform balance to promote proliferation, invasion and chemoresistance, making it an emerging therapeutic target.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; Machine learning-based selection of immune cell markers in osteosarcoma: prognostic determination and validation of CLK1 in disease progression; Authors - Nan Zhang