CLOCK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CLOCK Polyclonal antibody, PBS Only (18094-1-PBS)

• 

  WB analysis of HEK-293 using 18094-1-AP (same clone as 18094-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18094-1-AP (CLOCK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18094-1-AP (same clone as 18094-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18094-1-AP (CLOCK antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18094-1-AP (same clone as 18094-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18094-1-AP (CLOCK antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18094-1-AP (same clone as 18094-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18094-1-AP (CLOCK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 18094-1-AP (same clone as 18094-1-PBS)

  IP result of anti-CLOCK (IP:18094-1-AP, 4ug; Detection:18094-1-AP 1:300) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18094-1-AP (same clone as 18094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18094-1-AP (CLOCK antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18094-1-AP (same clone as 18094-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18094-1-AP (CLOCK antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 18094-1-AP (same clone as 18094-1-PBS)

  Immunofluorescent analysis of HeLa cells using 18094-1-AP (CLOCK antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18094-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CLOCK Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 18094-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

18094-1-PBS targets CLOCK in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12826

  Product name: Recombinant human CLOCK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC041878

  Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL

• Full Name: clock homolog (mouse)
• Calculated Molecular Weight: 846 aa, 95 kDa
• Observed Molecular Weight: 95-110 kDa
• GenBank Accession Number: BC041878
• Gene Symbol: CLOCK
• Gene ID (NCBI): 9575
• RRID: AB_2878497
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15516
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868).