• Featured Product
  • KD/KO Validated

CLOCK Recombinant monoclonal antibody, PBS Only

CLOCK Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA, ChIP-qPCR
Cat No. 82829-1-PBS
Clone No.1I23

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA, ChIP-qPCR

1I23, bHLHe8, Circadian locomoter output cycles protein kaput, Class E basic helix-loop-helix protein 8, EC:2.3.1.48

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82829-1-PBS targets CLOCK in WB, IHC, Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30011

Product name: Recombinant human CLOCK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC041878

Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL

Predict reactive species
Full Name clock homolog (mouse)
Calculated Molecular Weight 846 aa, 95 kDa
Observed Molecular Weight110 kDa
GenBank Accession NumberBC041878
Gene Symbol CLOCK
Gene ID (NCBI) 9575
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15516
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868).

Loading...
||
New chat

Able

正在加载,请稍候...