CLPP Recombinant monoclonal antibody, PBS Only (Capture/Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CLPP Recombinant monoclonal antibody, PBS Only (Capture/Detector) (87187-2-PBS)

• 

  Sandwich ELISA sample test of MP02909-2

  The mean CLPP concentration was determined to be 78.1 ng/mL in Raji cell extract based on a 1.2 mg/mL extract load, 26.3 ng/mL in HCT 116 cell extract based on a 1.2 mg/mL extract load and 21.4 ng/mL in HuH-7 cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02909-2

  Sandwich ELISA standard curve of MP02909-2, Human CLPP Recombinant Matched Antibody Pair - PBS only. 87187-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag8325. 87187-2-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Cytometric bead array sample test of MP02909-1

  The mean CLPP concentration was determined to be 42.8 ng/mL in Raji cell extract based on a 1.2 mg/mL extract load, 4.9 ng/mL in Ramos cell extract based on a 1.1 mg/mL extract load, 2.2 ng/mL in HuH-7 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02909-1

  Cytometric bead array standard curve of MP02909-1, CLPP Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87187-2-PBS. Detection antibody: 87187-1-PBS. Standard: Ag8325. Range: 0.156-20 ng/mL.

CLPP Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87187-2-PBS

Clone No.252470H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

87187-2-PBS targets CLPP as part of a matched antibody pair:

MP02909-1: 87187-2-PBS capture and 87187-1-PBS detection (validated in Cytometric bead array)

MP02909-2: 87187-3-PBS capture and 87187-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8325

  Product name: Recombinant human CLPP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC002956

  Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

• Full Name: ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: BC002956
• Gene Symbol: CLPP
• Gene ID (NCBI): 8192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16740
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.