CLPTM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CLPTM1 Polyclonal antibody, PBS Only (15337-1-PBS)

• 

  WB analysis using 15337-1-AP (same clone as 15337-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15337-1-AP (CLPTM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15337-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A549 using 15337-1-AP (same clone as 15337-1-PBS)

  IP result of anti-CLPTM1 (IP:15337-1-AP, 4ug; Detection:15337-1-AP 1:300) with A549 cells lysate 1050 ug. This data was developed using the same antibody clone with 15337-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15337-1-AP (same clone as 15337-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15337-1-AP (CLPTM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15337-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15337-1-AP (same clone as 15337-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15337-1-AP (CLPTM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15337-1-PBS in a different storage buffer formulation.

CLPTM1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15337-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Putative lipid scramblase CLPTM1

---

Product Information

15337-1-PBS targets CLPTM1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7538

  Product name: Recombinant human CLPTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC004865

  Sequence: MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKDTLMNLHVYISEHEHFTDFNATSALFWEQHDLVYGDWTSGENSDGCYEHFAELDIPQSVQQNGSIYIHVYFTKSGFHPDPRQKALYRRLATVHMSRMINKYKRRRFQKTKNLLTGETEADPEMIKRAEDYGPVEVISHWHPNITINIVDDHTPWVKGSVPPPLDQYVKFDAVSGDYYPIIYFNDYWNLQKDYYPINESLASLPLRVSFCPLSLWRWQLYAAQSTKSPWNFLGDELYEQSDEEQDSVKVALLE

• Full Name: cleft lip and palate associated transmembrane protein 1
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 65-75 kDa
• GenBank Accession Number: BC004865
• Gene Symbol: CLPTM1
• Gene ID (NCBI): 1209
• RRID: AB_3669204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96005
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cleft lip and palate transmembrane protein 1 (CLPTM1), a multipass transmembrane protein, was identified due to the association of a chromosomal translocation with a cleft lip and palate (PMID: 9828125). CLPTM1 regulates epileptic seizures by modulating GABAAR-mediated inhibitory synaptic transmission (PMID: 36519412). Highly expressed CLPTM1L may contribute to a poor prognosis and increase invasion, proliferation and migration of oral squamous cell carcinoma (PMID: 34586883).