CLTB Polyclonal antibody

• 

  WB analysis of mouse thymus using 10455-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10455-1-AP (CLTB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 10455-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10455-1-AP (CLTB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10455-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10455-1-AP (CLTB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10455-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10455-1-AP (CLTB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 10455-1-AP

  IP result of anti-CLTB (IP:10455-1-AP, 4ug; Detection:10455-1-AP 1:500) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human skin cancer using 10455-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 10455-1-AP (CLTB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 10455-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CLTB antibody (10455-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HEK-293 using 10455-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HEK-293 cells using CLTB antibody (10455-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CLTB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10455-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

LCB, clathrin, light chain (Lcb), Clathrin light chain B

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, human brain tissue, mouse brain tissue, PC-3 cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IF: See 1 publications below

Product Information

10455-1-AP targets CLTB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0707

  Product name: Recombinant human CLTB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC006457

  Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR

• Full Name: clathrin, light chain (Lcb)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 32-38 kDa
• GenBank Accession Number: BC006457
• Gene Symbol: CLTB
• Gene ID (NCBI): 1212
• RRID: AB_2083149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09497
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (180 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The light chain subunits are thought to regulate the formation or disassembly of clathrin coats. (PMID: 2445759; 8374173; 3563513)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Proc Natl Acad Sci U S A; Clathrin light chains' role in selective endocytosis influences antibody isotype switching.; Authors - Shuang Wu ; KD Validated
mouse	WB	Proc Natl Acad Sci U S A; Clathrin light chain diversity regulates membrane deformation in vitro and synaptic vesicle formation in vivo.; Authors - Lisa Redlingshöfer
human	WB	J Virol; Dabie bandavirus Nonstructural Protein Interacts with Actin to Induce F-Actin Rearrangement and Inhibit Viral Adsorption and Entry.; Authors - Hongyun Liu
human	IF	bioRxiv; Downregulation of lysosomal trafficking in ARPE19 cells leads to decreased transfection efficiency at high passage; Authors - Erika M S Hood