Clusterin Monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP50075-1

  Sandwich ELISA standard curve of MP50075-1, CLU Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68687-1-PBS. Detection antibody: 68687-2-PBS. Standard: Eg0225. Range: 0.313-20 ng/mL.

• 

  Sample test of MP50075-1

  HeLa and HepG2 were cultured in DMEM supplemented with 10% fetal bonive serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. An aliquot of the cell culture supernate was removed, assayed for human CLU, and measured 89.23 and 308.39 ng/mL.

• 

  Sample test of MP50075-1

  Serum of sixteen individual healthy human donors was measured. The human CLU concentration of detected samples was determined to be 371.79 µg/mL with a range of 248.44 - 583.26 µg/mL.

Clusterin Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68687-1-PBS

Clone No.2G4A9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

AAG4, Aging-associated gene 4 protein, Apo J, APOJ, Apo-J

---

Product Information

68687-1-PBS targets Clusterin as part of a matched antibody pair:

MP50075-1: 68687-1-PBS capture and 68687-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0225

  Product name: Recombinant Human CLU protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-449 aa of BC010514

  Sequence: DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10909
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.