CLUL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CLUL1 Polyclonal antibody (27498-1-AP)

• 

  WB analysis using 27498-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27498-1-AP (CLUL1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

CLUL1 Polyclonal Antibody for WB, ELISA

Cat No. 27498-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Retinal-specific clusterin-like protein, Clusterin-like protein 1, Clusterin like protein 1, clusterin like 1 (retinal)

---

Tested Applications

• Positive WB detected in: ARPE-19 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27498-1-AP targets CLUL1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26570

  Product name: Recombinant human CLUL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-124 aa of BC025381

  Sequence: APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNC

• Full Name: clusterin-like 1 (retinal)
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC025381
• Gene Symbol: CLUL1
• Gene ID (NCBI): 27098
• RRID: AB_3742235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15846
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clusterin-like protein 1 (CLUL1) functions as a molecular chaperone, protecting stressed proteins, and is upregulated in various neurodegenerative conditions, suggesting a role in defense against neuronal damage (PMID: 17148042). It is specifically expressed in cone photoreceptor cells and is regulated by the cone-rod homeobox (CRX) (PMID: 14507903). Mutations of CLUL1 were investigated in the context of age-related macular degeneration (AMD), a leading cause of blindness in the elderly (PMID: 17148042).