CLYBL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85399-4-RR (same clone as 85399-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85399-4-RR (CLYBL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85399-4-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 85399-4-RR (same clone as 85399-4-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 85399-4-RR (CLYBL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85399-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 85399-4-RR (same clone as 85399-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 85399-4-RR (CLYBL antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85399-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85399-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85399-4-RR against Human CLYBL were performed. The affinity constant is below 1 pM.

CLYBL Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85399-4-PBS

Clone No.242785F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

(3S)-malyl-CoA thioesterase, Beta-methylmalate synthase, Citramalyl-CoA lyase, mitochondrial, citrate lyase beta like, Citrate lyase beta-like

---

Product Information

85399-4-PBS targets CLYBL in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11283

  Product name: Recombinant human CLYBL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC034360

  Sequence: MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK

• Full Name: citrate lyase beta like
• Calculated Molecular Weight: 340 aa, 37 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC034360
• Gene Symbol: CLYBL
• Gene ID (NCBI): 171425
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N0X4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CLYBL, also named CLB, is a Mitochondrial citramalyl-CoA lyase indirectly involved in vitamin B12 metabolism (PubMed:29056341). It is a human mitochondrial enzyme of unknown function that is found in multiple eukaryotic taxa and conserved to bacteria. It acts as a beta-methylmalate synthase in vitro, by mediating the conversion of glyoxylate and propionyl-CoA to beta-methylmalate. There are two isoforms with MW 31-33 kDa and 35-37 kDa.