CMAS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CMAS Polyclonal antibody, PBS Only (13006-1-PBS)

• 

  WB analysis using 13006-1-AP (same clone as 13006-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13006-1-AP (CMAS antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13006-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13006-1-AP (same clone as 13006-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13006-1-AP (CMAS antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13006-1-AP (same clone as 13006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13006-1-AP (CMAS antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 13006-1-AP (same clone as 13006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13006-1-AP (CMAS antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13006-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 13006-1-AP (same clone as 13006-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CMAS antibody (13006-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 13006-1-PBS in a different storage buffer formulation.

CMAS Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13006-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CMP Neu5Ac SYNTHETASE, CMP NeuNAc synthase, CMP-N-acetylneuraminic acid synthase, CMP-NeuNAc synthase, EC:2.7.7.43

---

Product Information

13006-1-PBS targets CMAS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3686

  Product name: Recombinant human CMAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-263 aa of BC016609

  Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR

• Full Name: cytidine monophosphate N-acetylneuraminic acid synthetase
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC016609
• Gene Symbol: CMAS
• Gene ID (NCBI): 55907
• RRID: AB_3085404
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytidine monophosphate N-acetylneuraminic acid synthetase (CMAS), a key enzyme in the incorporation pathway, catalyzes the synthesis of CMP-sialic acid by utilizing CTP and sialic acid. Neu5Ac is activated in the nucleus by CMAS to form CMP-Neu5Ac, which is transported to the Golgi apparatus by SLC35A1 for sialylation of glycoproteins and gangliosides catalyzed by specific sialy ltransferases (PMID: 30568043). Low CMAS gene expression correlated with reduced recurrence-free survival in a human colorectal cancer cohort (PMID: 30578646). Western blots indicated a range of bands at ~ 48 kDa.