CMTM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CMTM1 Polyclonal antibody (34038-1-AP)

• 

  WB analysis using 34038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34038-1-AP (CMTM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CMTM1 Polyclonal Antibody for WB, ELISA

Cat No. 34038-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

2, Chemokine-like factor superfamily member 1, CKLF-like MARVEL transmembrane domain-containing protein 1, CKLFSF1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34038-1-AP targets CMTM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40585

  Product name: Recombinant human CMTM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 237-286 aa of BC057852

  Sequence: VIVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA

• Full Name: CKLF-like MARVEL transmembrane domain containing 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC057852
• Gene Symbol: CMTM1
• Gene ID (NCBI): 113540
• RRID: AB_3743141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IZ96
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CMTM1 is a MARVEL domain-containing membrane protein enriched in testis and epithelial tissues, with emerging roles in membrane trafficking and cell survival. Its frequent overexpression in multiple cancers and association with aggressive tumor behavior suggest that CMTM1 contributes to tumor progression, potentially by modulating membrane organization or receptor signaling. These properties position CMTM1 as a candidate biomarker and functional regulator in cancer biology (PMID: 33585698, 31542285).