CNIH2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNIH2 Polyclonal antibody, PBS Only (14260-1-PBS)

• 

  WB analysis using 14260-1-AP (same clone as 14260-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14260-1-AP (CNIH2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14260-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14260-1-AP (same clone as 14260-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14260-1-AP (CNIH2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14260-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14260-1-AP (same clone as 14260-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14260-1-AP (CNIH2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14260-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 14260-1-AP (same clone as 14260-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CNIH2 antibody (14260-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 14260-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 14260-1-AP (same clone as 14260-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CNIH2 antibody (14260-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 14260-1-PBS in a different storage buffer formulation.

CNIH2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14260-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CNIH-2, CNIL, Cornichon family AMPA receptor auxiliary protein 2, Cornichon like protein, Cornichon-like protein

---

Product Information

14260-1-PBS targets CNIH2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5533

  Product name: Recombinant human CNIH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC047953

  Sequence: MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWC

• Full Name: cornichon homolog 2 (Drosophila)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC047953
• Gene Symbol: CNIH2
• Gene ID (NCBI): 254263
• RRID: AB_3669181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PI25
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CNIH2, or cornichon family AMPA receptor auxiliary protein 2, is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype.CNIH2 has been reported to interact with the Type I AMPA Receptor regulatory protein isoform gamma-8, which controls the assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. It has been implicated in various diseases, including schizophrenia, as indicated by its association with different schizophrenia-related disorders.