CNIH4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CNIH4 Polyclonal antibody, PBS Only (15015-1-PBS)

• 

  WB analysis using 15015-1-AP (same clone as 15015-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15015-1-AP (CNIH4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15015-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 15015-1-AP (same clone as 15015-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CNIH4 antibody (15015-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15015-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 15015-1-AP (same clone as 15015-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CNIH4 antibody (15015-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15015-1-PBS in a different storage buffer formulation.

CNIH4 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 15015-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

CNIH-4, Cornichon family AMPA receptor auxiliary protein 4, HSPC163, Protein cornichon homolog 4

---

Product Information

15015-1-PBS targets CNIH4 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6965

  Product name: Recombinant human CNIH4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC000573

  Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLG

• Full Name: cornichon homolog 4 (Drosophila)
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC000573
• Gene Symbol: CNIH4
• Gene ID (NCBI): 29097
• RRID: AB_3741857
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P003
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CNIH4 (Cornichon Family Member 4) is a protein-coding gene belonging to the cornichon family, which plays a critical role in regulating G protein-coupled receptor (GPCR) trafficking from the endoplasmic reticulum to the cell surface. It facilitates GPCR export through the early secretory pathway and is regulated by TMED9.