• Featured Product
  • KD/KO Validated

CNN3 Polyclonal antibody

CNN3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11509-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Calponin 3, Calponin3, Calponin-3, CNN 3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HAP1 cells, human kidney tissue, human skeletal muscle tissue, HEK-293 cells, HepG2 cells, NIH/3T3 cells
Positive IP detected inHEK-293 cells, U-87MG cells
Positive IHC detected inhuman prostate cancer tissue, human hysteromyoma tissue, human skin tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11509-1-AP targets CNN3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2068

Product name: Recombinant human CNN3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-329 aa of BC025372

Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY

Predict reactive species
Full Name calponin 3, acidic
Calculated Molecular Weight 329 aa, 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC025372
Gene Symbol CNN3
Gene ID (NCBI) 1266
RRIDAB_2082140
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15417
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain. CNN3 is the thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction.

Protocols

Product Specific Protocols
WB protocol for CNN3 antibody 11509-1-APDownload protocol
IHC protocol for CNN3 antibody 11509-1-APDownload protocol
IF protocol for CNN3 antibody 11509-1-APDownload protocol
IP protocol for CNN3 antibody 11509-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Mol Ther Nucleic Acids

circRNA CDR1as Promotes Pulmonary Artery Smooth Muscle Cell Calcification by Upregulating CAMK2D and CNN3 via Sponging miR-7-5p.

Authors - Cui Ma
mouseIF

Cell Rep

Spatiotemporal dynamics of inner ear sensory and non-sensory cells revealed by single-cell transcriptomics.

Authors - Taha A Jan
humanWB

J Proteome Res

Comparative Proteomics Reveals Prolonged Corneal Preservation Impaired Ocular Surface Immunity Accompanied by Fibrosis in Human Stroma

Authors - Pei-Shan Wu
mouseIHC

Mol Cell Biochem

STAT3 mediates ECM stiffness-dependent progression in ovarian cancer

Authors - Sun Chenchen
humanWB

Gastroenterol Res Pract

PMID: 30911294

Authors - Keun-Seok Hong
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Elena (Verified Customer) (01-31-2025)

Great antibody. CNN3 antibody was used for Western blot for two different breast cancer cell lines. Very good signal in just 1 min of exposure with low background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: breast cancer cell lines (MDA-MB-231 and GILM2)
CNN3 Antibody Western Blot validation (1:1000 dilution) in breast cancer cell lines (MDA-MB-231 and GILM2) (Cat no:11509-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...