Tested Applications
| Positive WB detected in | HCT 116 cells, HAP1 cells, human kidney tissue, human skeletal muscle tissue, HEK-293 cells, HepG2 cells, NIH/3T3 cells |
| Positive IP detected in | HEK-293 cells, U-87MG cells |
| Positive IHC detected in | human prostate cancer tissue, human hysteromyoma tissue, human skin tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11509-1-AP targets CNN3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2068 Product name: Recombinant human CNN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC025372 Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY Predict reactive species |
| Full Name | calponin 3, acidic |
| Calculated Molecular Weight | 329 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC025372 |
| Gene Symbol | CNN3 |
| Gene ID (NCBI) | 1266 |
| RRID | AB_2082140 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15417 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain. CNN3 is the thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CNN3 antibody 11509-1-AP | Download protocol |
| IHC protocol for CNN3 antibody 11509-1-AP | Download protocol |
| IP protocol for CNN3 antibody 11509-1-AP | Download protocol |
| WB protocol for CNN3 antibody 11509-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CNN3 antibody (Cat# 11509-1-AP) has 7 citations published in journals including Cell Reports, JCI Insight, Molecular Therapy Nucleic Acids, Molecular and Cellular Biochemistry, Journal of Proteome Research, Atherosclerosis Plus, and Gastroenterology Research and Practice. Research fields span inner ear cell biology, rheumatoid arthritis, pulmonary artery calcification, ovarian cancer, ocular surface immunity, atherosclerosis, and gastric cancer, with applications in IF, IHC, and WB across mouse and human samples.
| Species | Application | Title |
|---|---|---|
Cell Rep Spatiotemporal dynamics of inner ear sensory and non-sensory cells revealed by single-cell transcriptomics. | ||
JCI Insight Lactate programs CRIP1 protein lactylation to drive synovial proliferation in rheumatoid arthritis. | ||
Mol Ther Nucleic Acids circRNA CDR1as Promotes Pulmonary Artery Smooth Muscle Cell Calcification by Upregulating CAMK2D and CNN3 via Sponging miR-7-5p. | ||
J Proteome Res Comparative Proteomics Reveals Prolonged Corneal Preservation Impaired Ocular Surface Immunity Accompanied by Fibrosis in Human Stroma | ||
Atheroscler Plus CNN3 promotes vascular smooth muscle cells proliferation and migration to deteriorate atherosclerosis by β-catenin signaling pathway.
|
Reviews
What customers say
The CNN3 antibody (11509-1-AP) received a 5-star rating for Western Blot use in breast cancer cell lines (MDA-MB-231 and GILM2). The reviewer reported excellent performance at a 1:1000 dilution, noting very strong signal with only 1 minute of exposure and low background. Overall, the product was described as a great antibody delivering clear, reliable results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Elena (Verified Customer) (01-31-2025) | Great antibody. CNN3 antibody was used for Western blot for two different breast cancer cell lines. Very good signal in just 1 min of exposure with low background.
 |
