CoraLite® Plus 488-conjugated CNOT4 Monoclonal antibody

• 

  IF Staining of human colon cancer using CL488-67798

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CoraLite® Plus 488 CNOT4 antibody (CL488-67798, Clone: 4H5H3 ) at dilution of 1:200.

• 

  IF Staining of human colon cancer using CL488-67798

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CoraLite® Plus 488 CNOT4 antibody (CL488-67798, Clone: 4H5H3 ) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL488-67798

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 CNOT4 antibody (CL488-67798, Clone: 4H5H3 ) at dilution of 1:800.

CNOT4 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL488-67798

Clone No.4H5H3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P

Synonyms

E3 ubiquitin-protein ligase CNOT4, CLONE243, CCR4-NOT transcription complex subunit 4, CCR4-associated factor 4, CCR4 associated factor 4

---

Tested Applications

• Positive IF-P detected in: human colon cancer tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67798 targets CNOT4 in IF/ICC, IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29964

  Product name: Recombinant human CNOT4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 273-572 aa of BC035590

  Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA

• Full Name: CCR4-NOT transcription complex, subunit 4
• Calculated Molecular Weight: 575 aa, 64 kDa
• GenBank Accession Number: BC035590
• Gene Symbol: CNOT4
• Gene ID (NCBI): 4850
• RRID: AB_2919550
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95628
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa.